Jiangsu Biostronger Technology Co, Ltd

HGH, Peptitler, IGF-1 LR3, EGF, VEGF, Steroidler ve SARMs tozu, vb.

Ev
Ürün:% s
Hakkımızda
Fabrika turu
Kalite kontrol
Bize Ulaşın
Teklif isteği
Ana sayfa Ürünler

IGF Büyüme Hormonu

Ben sohbet şimdi
Peter ile siparişi tamamladım ve servisi A +++. Onu başka bir yere tahtada yayınladım. Onun gh ile bir gh serum testi yaptım ve 10iu için daha fazla 30, çılgın yüksek puan geri geliyor.

—— ABD'den Ricky Rodrig

Çok ve Peter ile çok etkilendim. Mükemmel iletişim ve genel müşteri hizmetleri! A +++++. kesinlikle sizinle iş yapacak.

—— İngiltere'den Trevor Maki

IGF Büyüme Hormonu

(10)
Çin Vücut Builder İçin Yüksek Saf IGF Büyüme Hormonu Etiketli Riptropin Cas NO 12629-01-5 Fabrika

Vücut Builder İçin Yüksek Saf IGF Büyüme Hormonu Etiketli Riptropin Cas NO 12629-01-5

Vücut Builder İçin Yüksek Saf IGF Büyüme Hormonu Etiketli Riptropin Cas NO 12629-01-5 Cas No. 12629-01-5 Etiketler: Riptropin Eş anlamlı: İnsan Büyüme Hormonu Moleküler Formül: CC990H1529N263O299S7 MW: 22124.12 ... Daha fazla bilgi edinin En iyi fiyat
2018-12-19 10:06:10
Çin Vücut Geliştirme Fonksiyonları İçin HGH Büyüme Faktörü Etiketli Strongtropin HGH CAS 12629-01-5 Fabrika

Vücut Geliştirme Fonksiyonları İçin HGH Büyüme Faktörü Etiketli Strongtropin HGH CAS 12629-01-5

Cas No. 12629-01-5 Boyutu: 10iu / flakon Eş anlamlı: İnsan Büyüme Hormonu Moleküler Formül: CC990H1529N263O299S7 MW: 22124.12 Görünüm: Beyaz Toz Sıra: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIP... Daha fazla bilgi edinin En iyi fiyat
2018-12-19 10:06:10
Çin Cilt Tabaklama ve Cinsiyet Yeteneği için CAS No 121062-08-6 IGF Büyüme Hormonu Üst Saf Peptid Melanotan-II Fabrika

Cilt Tabaklama ve Cinsiyet Yeteneği için CAS No 121062-08-6 IGF Büyüme Hormonu Üst Saf Peptid Melanotan-II

Cas No. 121062-08-6 Eş Anlamlı Sözcükler : Melanotan-II Moleküler Formül: C50H69N15O9 MW: 1024.18 Sıra: Ac-Nle-siklo (-beta-Asp-His-D-Phe-Arg-Trp-epsilon-Lys-NH2) Saflık: > 98% Bakteriyel Endotoksinler: Daha fazla bilgi edinin En iyi fiyat
2018-12-19 10:06:10
Çin IGF-1 LR3 İnsan Büyüme Hormonu Protein CAS 946870-92-4 IGF Kas Büyümesini Kazanmak İçin Kas Fabrika

IGF-1 LR3 İnsan Büyüme Hormonu Protein CAS 946870-92-4 IGF Kas Büyümesini Kazanmak İçin Kas

Cas No. 946870-92-4 Boyutu: 1mg / flakon Eş anlamlılar: İnsülin-Benzeri Büyüme Faktörü-I LR3 MW: 9,1 K Görünüm: Beyaz Toz Sıra: 'H-Met-Phe-Pro-Ala-Met-Pro-Leu-Ser-Ser-Leu-Phe-Val-Asn-Gly-Pro-Arg-Thr-Leu-Cys-GIy... Daha fazla bilgi edinin En iyi fiyat
2018-12-19 10:06:10
Çin Kas Kazanç İçin İnsan IGF Büyüme Hormonu Protein CAS 946870-92-4 etiketleri Fabrika

Kas Kazanç İçin İnsan IGF Büyüme Hormonu Protein CAS 946870-92-4 etiketleri

Cas No. 946870-92-4 Boyutu: 1mg / flakon Eş anlamlılar: İnsülin-Benzeri Büyüme Faktörü-I LR3 MW: 9,1 K Görünüm: Beyaz Toz Sıra: 'H-Met-Phe-Pro-Ala-Met-Pro-Leu-Ser-Ser-Leu-Phe-Val-Asn-Gly-Pro-Arg-Thr-Leu-Cys-GIy... Daha fazla bilgi edinin En iyi fiyat
2018-12-19 13:43:09
Çin Kilo Kaybı için IGF-1 DES 1mg / flakon Büyüme Hormonu Fabrika

Kilo Kaybı için IGF-1 DES 1mg / flakon Büyüme Hormonu

Cas No. N / A Eş Anlamlılar: IGF-1 DES MW: 7371.4 Görünüm: Beyaz Toz Saflık: > 95% (HPLC) Kaynak: Kimyasal Sentez Sıra: 'H-Thr-Leu-Cys-GIy-Ala-Glu-Leu-Val-Asp-Ala-Leu-Gln-Phe-Val-Cys-Gly-Asp-Arg-Gly-Phe-Tyr-Phe... Daha fazla bilgi edinin En iyi fiyat
2018-12-19 10:06:10
Çin Kas Bina IGF Büyüme Hormonu Peptid IGF-1 LR3 Kas Kazancı CAS 946870-92-4 Fabrika

Kas Bina IGF Büyüme Hormonu Peptid IGF-1 LR3 Kas Kazancı CAS 946870-92-4

Cas No. 946870-92-4 Boyutu: 0.1mg / flakon Eş anlamlılar: İnsülin-Benzeri Büyüme Faktörü-I LR3 MW: 9,1 K Görünüm: Beyaz Toz Sıra: 'H-Met-Phe-Pro-Ala-Met-Pro-Leu-Ser-Ser-Leu-Phe-Val-Asn-Gly-Pro-Arg-Thr-Leu-Cys... Daha fazla bilgi edinin En iyi fiyat
2018-12-19 10:06:10
Çin IGF liyofilize Toz PT - 141 CAS 189691 06 3 Bremelanotide Cinsellik Yeteneği Fabrika

IGF liyofilize Toz PT - 141 CAS 189691 06 3 Bremelanotide Cinsellik Yeteneği

IGF liyofilize Toz PT - 141 CAS 189691 06 3 Bremelanotide Cinsellik Yeteneği Cas No. 189691-06-3 Eş Anlamlı Sözcükler : Brmelanotice; BREMELANOTIDE PT141; BreMelanotide Asetat Moleküler Formül: C50H68N14O10 MW: ... Daha fazla bilgi edinin En iyi fiyat
2018-12-19 10:06:10
Çin Tiyosin Beta 4 IGF Büyüme Hormonu TB500 Peptitler CAS NO 77591-33-4 Şifa Yaralanmaları Ve Kas Binaları İçin Fabrika

Tiyosin Beta 4 IGF Büyüme Hormonu TB500 Peptitler CAS NO 77591-33-4 Şifa Yaralanmaları Ve Kas Binaları İçin

Cas No. 77591-33-4 Eş anlamlı kelimeler: Thymosin Beta 4 Moleküler Formül: C212H350N56O78S MW: 4963.44 Sıra: Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Glu Lys... Daha fazla bilgi edinin En iyi fiyat
2018-12-19 10:06:10
Çin Kilo Kaybı için Vücut Geliştirme CAS 12629-01-5 HGH Büyüme Hormonu IGF Fabrika

Kilo Kaybı için Vücut Geliştirme CAS 12629-01-5 HGH Büyüme Hormonu IGF

Kilo Kaybı için Vücut Geliştirme CAS 12629-01-5 HGH Büyüme Hormonu IGF Cas No. 12629-01-5 Boyutu: 5iu / flakon Eş anlamlı: İnsan Büyüme Hormonu Moleküler Formül: CC990H1529N263O299S7 MW: 22124.12 Görünüm: Beyaz ... Daha fazla bilgi edinin En iyi fiyat
2018-12-19 10:06:10
Page 1 of 1